| CatalogCode: | | H00001027-B03 |
| ProductName: | | CDKN1B Antibody |
| Product Description: | | Mouse Polyclonal anti-CDKN1B - cyclin-dependent kinase inhibitor 1B (p27, Kip1), MaxPab Antibody |
| Clonality: | | Polyclonal |
| Immunogen: | | CDKN1B (NP_004055, 1 a.a. ~ 198 a.a) full-length human protein. |
| Epitope: | | MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT ... |
| CrossReactivity: | | Human. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| Background: | | This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | WB, ELISA |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-CDKN4 antibody, anti-KIP1 antibody, anti-P27KIP1 antibody |
| ProteinTarget: | | cyclin-dependent kinase inhibitor 1B (p27, Kip1) |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | | 1027 |
| Gene_Symbol: | | CDKN1B |
| more information: | | company product webpage |