ExactAntigen

Mouse Monoclonal anti-CDK8 (5H4) | Novus Biologicals antibody product information
CatalogCode:H00001024-M03
ProductName:CDK8 Antibody
Product Description:Mouse Monoclonal anti-CDK8 (5H4)
Clone:5H4
Clonality:Monoclonal
Immunogen:CDK8 (NP_001251, 375 a.a. ~ 464 a.a) partial recombinant protein with GST tag.
Epitope:QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY ...
Specificity:CDK8 - cyclin-dependent kinase 8
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This kinase and its regulatory subunit cyclin C are components of the RNA polymerase II holoenzyme complex, which phosphorylates the carboxy-terminal domain (CTD) of the largest subunit of RNA polymerase II. This kinase has also been shown to regulate transcription by targeting the CDK7/cyclin H subunits of the general transcription initiation factor IIH (TFIIH), thus providing a link between the 'Mediator-like' protein complexes and the basal transcription machinery.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-cyclin-dependent kinase 8 antibody, anti-K35 antibody, anti-MGC126074 antibody, anti-MGC126075 antibody
ProteinTarget:CDK8 - cyclin-dependent kinase 8
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:1024
Gene_Symbol:CDK8
Omim_ID:603184,
order or
more information
:
company product webpage
request information:
Also see:
all human CDK8 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about