| Catalog Code: | H00001022-M01 |
| Product Type: | Primary Antibody |
| Product Name: | CDK7 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 1022 |
| Host: | Mouse |
| Clone: | 1G5 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-CDK7 (1G5) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = CDK7 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encoded |
| Alternate Names: | anti-CAK1 antibody, anti-CDKN7 antibody, anti-STK1 antibody, anti-p39MO15 antibody |
| Immunogen: | CDK7 (AAH00834, 1 a.a. ~ 347 a.a) full length recombinant protein with GST tag. |
| Epitope: | MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGI ... |
| Specificity: | CDK7 - cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase) |
| Purity: | IgG purified |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Application Summary: | ELISA |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | CDK7 |
| Omim ID: | 601955, |