| CatalogCode: | H00001022-A01 |
| ProductName: | CDK7 Antibody |
| Product Description: | Mouse Polyclonal anti-CDK7 |
| Clonality: | Polyclonal |
| Immunogen: | CDK7 (AAH00834, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. |
| Epitope: | MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQ ... |
| Specificity: | CDK7 - cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CAK1 antibody, anti-CDKN7 antibody, anti-STK1 antibody, anti-p39MO15 antibody |
| ProteinTarget: | CDK7 - cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 1022 |
| Gene_Symbol: | CDK7 |
| Omim_ID: | 601955 H00001022-M01 |