ExactAntigen

CDC25C Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000995-B01
Product Type:Primary Antibody
Product Name:CDC25C Antibody
List Price:295
Clonality:Polyclonal
Gene ID:995
Host:Mouse
Product Description:Mouse Polyclonal anti-CDC25C - cell division cycle 25C, MaxPab Antibody
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene is a member of the EGF-TM7 family of class II seven-span transmembrane (7-TM) molecules, likely encoded by a gene cluster on the short arm of chromosome 19. The encoded product is a glycoprotein that is present on the surface of most activated l
Alternate Names:anti-CDC25 antibody
Immunogen:CDC25C (NP_001781, 1 a.a. ~ 473 a.a) full-length human protein.
Epitope:MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKG ...
Preservative:No Preservative
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:WB, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
see all human CDC25C antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about