| CatalogCode: | | H00000955-A01 |
| ProductName: | | ectonucleoside triphosphate diphosphohydrolase 6 Antibody |
| Product Description: | | Mouse Polyclonal anti-ectonucleoside triphosphate diphosphohydrolase 6 |
| Clonality: | | Polyclonal |
| Immunogen: | | ENTPD6 (NP_001238, 386 a.a. ~ 485 a.a) partial recombinant protein with GST tag. |
| Epitope: | | YDLAAGVGLIDAEKGGSLVVGDFEIAAKYVCRTLETQPQSSPFSCMDLTYVSLLLQEFGFPRSKVLKLTRKIDNVETSWALGAIFHYIDSLNRQKSPAS* ... |
| Specificity: | | ectonucleoside triphosphate diphosphohydrolase 6 (putative function) |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Other applications have not been tested. |
| Background: | | ENTPD6 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD6 contains 4 apyrase-conserved regions which is characteristic of NTPases. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-CD39L2 antibody, anti-IL-6SAG antibody, anti-IL6ST2 antibody, anti-NTPDase-6 antibody, anti-dJ738P15.3 antibody |
| ProteinTarget: | | ectonucleoside triphosphate diphosphohydrolase 6 (putative function) |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 955 |
| Gene_Symbol: | | ENTPD6 |
| Omim_ID: | | 603160, |
| more information: | | company product webpage |