ExactAntigen

TNFSF8 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000944-M01
Product Type:Primary Antibody
Product Name:TNFSF8 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:944
Host:Mouse
Clone:2E11
Isotype:IgM Kappa
Product Description:Mouse Monoclonal anti-TNFSF8 (2E11)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = TNFSF8 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encode
Alternate Names:anti-CD153 antibody, anti-CD30L antibody, anti-CD30LG antibody
Immunogen:TNFSF8 (NP_001235, 153 a.a. ~ 235 a.a) partial recombinant protein with GST tag.
Epitope:NNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD* ...
Specificity:TNFSF8 - tumor necrosis factor (ligand) superfamily, member 8
Purity:IgG purified
Packaging:100 ul of ascites
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:TNFSF8
Omim ID:603875,
see all human CD30 ligand antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about