ExactAntigen

Mouse Polyclonal anti-TNFSF8 | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00000944-A01
ProductName: TNFSF8 Antibody
Product Description: Mouse Polyclonal anti-TNFSF8
Clonality: Polyclonal
Immunogen: TNFSF8 (NP_001235, 153 a.a. ~ 235 a.a) partial recombinant protein with GST tag.
Epitope: NNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD* ...
Specificity: TNFSF8 - tumor necrosis factor (ligand) superfamily, member 8
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses: The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Background: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: Whole antisera
Host_Name: Mouse
ListPrice: 225
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-CD153 antibody, anti-CD30L antibody, anti-CD30LG antibody
ProteinTarget: TNFSF8 - tumor necrosis factor (ligand) superfamily, member 8
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 944
Gene_Symbol: TNFSF8
Omim_ID: 603875 H00000944-M01
more information: company product webpage
Also see:
see all human CD30 ligand antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about