ExactAntigen

TNFRSF8 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000943-M01
Product Type:Primary Antibody
Product Name:TNFRSF8 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:943
Host:Mouse
Clone:3B9
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-TNFRSF8 (3B9)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = TNFRSF8 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encod
Alternate Names:anti-CD30 antibody, anti-D1S166E antibody, anti-KI-1 antibody
Immunogen:TNFRSF8 (NP_001234, 21 a.a. ~ 134 a.a) partial recombinant protein with GST tag.
Epitope:QDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPA* ...
Specificity:TNFRSF8 - tumor necrosis factor receptor superfamily, member 8
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:TNFRSF8
Omim ID:153243
see all human CD30 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about