ExactAntigen

Mouse Polyclonal anti-MS4A3 - membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00000932-B01
ProductName: MS4A3 Antibody
Product Description: Mouse Polyclonal anti-MS4A3 - membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific)
Clone: membrane-spanning 4-domains, subfamily A
Clonality: Polyclonal
Immunogen: MS4A3 (AAH08487, 1 a.a. ~ 215 a.a) full-length human protein.MW of the GST tag alone is 26 KDa.
Epitope: MASHEVDNAELGSASARGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQNSFGMNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCNSREEISSPPNSV* ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml of mouse antisera with 50% glycerol.
Uses: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background: This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member likely plays a role in signal transduction and may function as a subunit associated with receptor complexes. The gene encoding this protein is localized to 11q12, among a cluster of related family members. Alternative splicing may result in multiple transcript variants; however, not all variants have been fully described.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name: Mouse
ListPrice: 295
AppSummary: WB, ELISA
SpeciesSummary: Hu
ALTnames: anti-CD20L antibody, anti-HTM4 antibody
ProteinTarget: membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific)
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id: 932
Gene_Symbol: MS4A3
more information: company product webpage
Also see:
see all human MS4A3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about