| CatalogCode: | | H00000932-B01 |
| ProductName: | | MS4A3 Antibody |
| Product Description: | | Mouse Polyclonal anti-MS4A3 - membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific) |
| Clone: | | membrane-spanning 4-domains, subfamily A |
| Clonality: | | Polyclonal |
| Immunogen: | | MS4A3 (AAH08487, 1 a.a. ~ 215 a.a) full-length human protein.MW of the GST tag alone is 26 KDa. |
| Epitope: | | MASHEVDNAELGSASARGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQNSFGMNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCNSREEISSPPNSV* ... |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | | This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member likely plays a role in signal transduction and may function as a subunit associated with receptor complexes. The gene encoding this protein is localized to 11q12, among a cluster of related family members. Alternative splicing may result in multiple transcript variants; however, not all variants have been fully described. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | WB, ELISA |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-CD20L antibody, anti-HTM4 antibody |
| ProteinTarget: | | membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific) |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | | 932 |
| Gene_Symbol: | | MS4A3 |
| more information: | | company product webpage |