ExactAntigen

Mouse Polyclonal anti-CD8B1
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00000926-A01
ProductName:CD8B1 Antibody
Product Description:Mouse Polyclonal anti-CD8B1
Clonality:Polyclonal
Immunogen:CD8B1 (NP_004922, 23 a.a. ~ 132 a.a) partial recombinant protein with GST tag.
Epitope:QQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQ* ...
Specificity:CD8B1 - CD8 antigen, beta polypeptide 1 (p37)
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Background:The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigen displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 beta chain isoforms. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host_Name:Mouse
ListPrice:225
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-CD8B antibody, anti-LYT3 antibody, anti-Leu2 antibody, anti-Ly3 antibody
ProteinTarget:CD8B1 - CD8 antigen, beta polypeptide 1 (p37)
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:926
Gene_Symbol:CD8B1
Omim_ID:186730 H00000926-M07
see all human CD8B antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about