ExactAntigen

CD3G Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000917-M01
Product Type:Primary Antibody
Product Name:CD3G Antibody
List Price:275
Clonality:Monoclonal
Gene ID:917
Host:Mouse
Clone:2A6
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-CD3G (2A6)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = CD3G PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.T cell antigen recep
Alternate Names:anti-CD3-GAMMA antibody, anti-T3G antibody
Immunogen:CD3G (NP_000064, 23 a.a. ~ 112 a.a) partial recombinant protein with GST tag.
Epitope:QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN* ...
Specificity:CD3G - CD3G antigen, gamma polypeptide (TiT3 complex)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:CD3G
Omim ID:186740
see all human CD3G antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about