| CatalogCode: | | H00000911-A01 |
| ProductName: | | CD1C Antibody |
| Product Description: | | Mouse Polyclonal anti-CD1C |
| Clonality: | | Polyclonal |
| Immunogen: | | CD1C (NP_001756, 77 a.a. ~ 186 a.a) partial recombinant protein with GST tag. |
| Epitope: | | SNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTC* ... |
| Specificity: | | CD1C antigen, c polypeptide |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Other applications have not been tested. |
| Background: | | This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene is broadly distributed throughout the endocytic system via a tyrosine-based motif in the cytoplasmic tail. Alternatively spliced transcript variants of this gene have been observed, but their full-length nature is not known. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-CD1 antibody, anti-a1 domain antibody |
| ProteinTarget: | | CD1C antigen, c polypeptide |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 911 |
| Gene_Symbol: | | CD1C |
| Omim_ID: | | 188340, |
| more information: | | company product webpage |