| CatalogCode: | H00000885-B01 |
| ProductName: | CCK Antibody |
| Product Description: | Mouse Polyclonal anti-CCK - cholecystokinin, MaxPab Antibody |
| Clonality: | Polyclonal |
| Immunogen: | CCK (AAH08283, 1 a.a. ~ 116 a.a) full-length human protein. |
| Epitope: | MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against transfected protein with on ELISA and Western Blot. Untransfected protein used as a negative control. |
| Control: | H00000885-T01 |
| Background: | Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | WB, ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-MGC117187 antibody |
| ProteinTarget: | cholecystokinin |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | 885 |
| Gene_Symbol: | CCK |
order or
more information: | company product webpage |
| request information: |
|