ExactAntigen

CBR1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000873-M02
Product Type:Primary Antibody
Product Name:CBR1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:873
Host:Mouse
Clone:4D12-1G8
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-CBR1 (4D12-1G8)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = CBR1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.Carbonyl reductase i
Alternate Names:anti-Carbonyl Reductase 1 antibody, anti-CRN antibody, anti-CBR antibody, anti-hCBR1 antibody
Immunogen:CBR1 (AAH02511, 1 a.a. ~ 278 a.a) full length recombinant protein with GST tag.
Epitope:MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLA ...
Specificity:CBR1 - carbonyl reductase 1
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Product References:Lakhman SS, Blanco JG. et al. Functional characterization of the promoter of human carbonyl reductase 1 (CBR1). Role of XRE elements in mediating induction of CBR1 by ligands of the aryl hydrocarbon receptor. Mol Pharmacol. 2007 Jun 14; [Epub ahead of pri
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:CBR1
Omim ID:114830,
see all human CBR1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about