| CatalogCode: | H00000860-M02 |
| ProductName: | RUNX2 Antibody |
| Product Description: | Mouse Monoclonal anti-RUNX2 (2B9) |
| Clone: | 2B9 |
| Clonality: | Monoclonal |
| Immunogen: | RUNX2 (NP_004339, 251 a.a. ~ 351 a.a) partial recombinant protein with GST tag. |
| Epitope: | NPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGA* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | This gene is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis and acts as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants that encode different protein isoforms result from the use of alternate promoters as well as alternate splicing. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-AML3 antibody, anti-CBFA1 antibody, anti-CCD antibody, anti-CCD1 antibody, anti-MGC120022 antibody, anti-MGC120023 antibody, anti-OSF2 antibody, anti-PEA2aA antibody, anti-PEBP2A1 antibody, anti-PEBP2A2 antibody, anti-PEBP2aA antibody, anti-PEBP2aA1 antibody |
| ProteinTarget: | runt-related transcription factor 2 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 860 |
| Gene_Symbol: | RUNX2 |
| Omim_ID: | 119600, 600211, |
order or more information: | company product webpage |
| request information: | |