| CatalogCode: | H00000845-M01 |
| ProductName: | CASQ2 Antibody |
| Product Description: | Mouse Monoclonal anti-CASQ2 (1B6) |
| Clone: | 1B6 |
| Clonality: | Monoclonal |
| Immunogen: | CASQ2 (AAH22288, 20 a.a. ~ 400 a.a) full length recombinant protein with GST tag. |
| Epitope: | EEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFA ... |
| Specificity: | CASQ2 - calsequestrin 2 (cardiac muscle) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene specifies the cardiac muscle family member of the calsequestrin family. Calsequestrin is localized to the sarcoplasmic reticulum in cardiac and slow skeletal muscle cells. The protein is a calcium binding protein that stores calcium for muscle function. Mutations in this gene cause stress-induced polymorphic ventricular tachycardia, also referred to as catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), a disease characterized by bidirectional ventricular tachycardia that may lead to cardiac arrest. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| NovusRef: | 1. Leatherbury L, Yu Q, Chatterjee B, et al. A novel mouse model of X-linked cardiac hypertrophy. Am J Physiol Heart Circ Physiol. April 18, 2008:00160.2007. |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ProteinTarget: | CASQ2 - calsequestrin 2 (cardiac muscle) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 845 |
| Gene_Symbol: | CASQ2 |