| CatalogCode: | H00000844-M01 |
| ProductName: | CASQ1 Antibody |
| Product Description: | Mouse Monoclonal anti-CASQ1 (1D7) |
| Clone: | 1D7 |
| Clonality: | Monoclonal |
| Immunogen: | CASQ1 (NP_001222, 29 a.a. ~ 131 a.a) partial recombinant protein with GST tag. |
| Epitope: | QEGLDFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLTEVDSMYVFKGDE* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | The protein encoded by this gene is a mitochondrial calcium-binding protein located in the luminal space of the terminal cisternae of the sarcoplasmic reticulum. The protein binds and putatively stores calcium ions. The protein is absent in patients with Duchenne and Becker types of muscular dystrophy. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG3 Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CALMITINE antibody, anti-CASQ antibody, anti-PDIB1 antibody |
| ProteinTarget: | calsequestrin 1 (fast-twitch, skeletal muscle) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 844 |
| Gene_Symbol: | CASQ1 |
| Omim_ID: | 114250, |
order or
more information: | company product webpage |
| request information: |
|