| CatalogCode: | H00000835-A01 |
| ProductName: | CASP2 Antibody |
| Product Description: | Mouse Polyclonal anti-CASP2 |
| Clonality: | Polyclonal |
| Immunogen: | CASP2 (AAH02427, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. |
| Epitope: | TLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRS ... |
| Specificity: | CASP2 - caspase 2, apoptosis-related cysteine protease (neural precursor cell expressed, developmentally down-regulated 2) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. The proteolytic cleavage of this protein is induced by a variety of apoptotic stimuli. Alternative splicing of this gene results in multiple transcript variants that encode different isoforms. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CASP-2 antibody, anti-ICH-1L antibody, anti-ICH-1L/1S antibody, anti-ICH1 antibody, anti-NEDD2 antibody |
| ProteinTarget: | CASP2 - caspase 2, apoptosis-related cysteine protease (neural precursor cell expressed, developmentally down-regulated 2) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 835 |
| Gene_Symbol: | CASP2 |
| Omim_ID: | 600639 H00000835-M10 |