ExactAntigen

Mouse Monoclonal anti-CASP1 (3D2)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00000834-M01
ProductName:CASP1 Antibody
Product Description:Mouse Monoclonal anti-CASP1 (3D2)
Clone:3D2
Clonality:Monoclonal
Immunogen:CASP1 (AAH62327, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Epitope:MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLL ...
Specificity:CASP1 - caspase 1, apoptosis-related cysteine protease (interleukin 1, beta, convertase)
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been used in Immunohistochemistry of paraffin embedded sections.
Background:This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing of this gene results in five transcript variants encoding distinct isoforms.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB, IHC-P
SpeciesSummary:Hu
ALTnames:anti-ICE antibody, anti-IL1BC antibody, anti-P45 antibody
ProteinTarget:CASP1 - caspase 1, apoptosis-related cysteine protease (interleukin 1, beta, convertase)
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:834
Gene_Symbol:CASP1
Omim_ID:147678 H00000843-A01
see all human CASP1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about