| CatalogCode: | H00000823-B01 |
| ProductType: | Primary Antibody |
| ProductName: | CAPN1 Antibody |
| ListPrice: | 295 |
| Clonality: | Polyclonal |
| Gene_Id: | 823 |
| Host: | Mouse |
| ProductDescription: | Mouse Polyclonal anti-CAPN1 - calpain 1, (mu/I) large subunit, MaxPab Antibody |
| CrossReactivity: | Human. |
| SpeciesSummary: | Hu |
| Background: | The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct |
| ALTnames: | anti-CANP antibody, anti-CANPL1 antibody, anti-muCANP antibody, anti-muCL antibody |
| Immunogen: | CAPN1 (NP_005177, 1 a.a. ~ 714 a.a) full-length human protein. |
| Epitope: | MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEAFPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILKALERGSLLGCSIDIS ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| AppSummary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C.á Avoid freeze-thaw cycles. |