| CatalogCode: | H00000822-A01 |
| ProductName: | CAPG Antibody |
| Product Description: | Mouse Polyclonal anti-CAPG |
| Clonality: | Polyclonal |
| Immunogen: | CAPG (NP_001738, 249 a.a. ~ 349 a.a) partial recombinant protein with GST tag. |
| Epitope: | AALYKVSDATGQMNLTKVADSSPFALELLISDDCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEGFISRMQYAPNTQVEILPQGHESPIFKQFFKDWK* ... |
| Specificity: | Mouse polyclonal antibody raised against a partial recombinant CAPG. |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to ELISA and Western blot on the immunizing protein.Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a member of the gelsolin/villin family of actin-regulatory proteins. The encoded protein reversibly blocks the barbed ends of F-actin filaments in a Ca2+ and phosphoinositide-regulated manner, but does not sever preformed actin filaments. By capping the barbed ends of actin filaments, the encoded protein contributes to the control of actin-based motility in non-muscle cells. Alternatively spliced transcript variants have been observed, but have not been fully described. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-AFCP antibody, anti-MCP antibody |
| ProteinTarget: | CAPG |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 822 |
| Gene_Symbol: | CAPG |
| Omim_ID: | 153615, |
order or
more information: | company product webpage |
| request information: |
|