ExactAntigen

C2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000717-B01
Product Type:Primary Antibody
Product Name:C2 Antibody
List Price:295
Clonality:Polyclonal
Gene ID:717
Host:Mouse
Product Description:Mouse Polyclonal anti-C2 - complement component 2, MaxPab Antibody
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.
Alternate Names:anti-CO2 antibody, anti-DKFZp779M0311 antibody
Immunogen:C2 (AAH29781, 20 a.a. ~ 329 a.a) full-length human protein.
Epitope:SAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPASRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDGFILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSNLVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRSGHLNLYLLLDCSQSVSENDFLIFK ...
Preservative:No Preservative
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:WB, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
see all human C2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about