| Catalog Code: | H00000717-B01 |
| Product Type: | Primary Antibody |
| Product Name: | C2 Antibody |
| List Price: | 295 |
| Clonality: | Polyclonal |
| Gene ID: | 717 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-C2 - complement component 2, MaxPab Antibody |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases. |
| Alternate Names: | anti-CO2 antibody, anti-DKFZp779M0311 antibody |
| Immunogen: | C2 (AAH29781, 20 a.a. ~ 329 a.a) full-length human protein. |
| Epitope: | SAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPASRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDGFILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSNLVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRSGHLNLYLLLDCSQSVSENDFLIFK ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |