| Catalog Code: | H00000708-M01 |
| Product Type: | Primary Antibody |
| Product Name: | C1QBP Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 708 |
| Host: | Mouse |
| Clone: | 1F3 |
| Isotype: | IgG1 Kappa |
| Product Description: | Mouse Monoclonal anti-C1QBP (1F3) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = C1QBP PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The human complemen |
| Alternate Names: | anti-GC1QBP antibody, anti-HABP1 antibody, anti-SF2p32 antibody, anti-gC1Q-R antibody, anti-gC1qR antibody, anti-p32 antibody |
| Immunogen: | C1QBP (NP_001203, 173 a.a. ~ 283 a.a) partial recombinant protein with GST tag. |
| Epitope: | IKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ* ... |
| Specificity: | C1QBP - complement component 1, q subcomponent binding protein |
| Purity: | IgG purified |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Application Summary: | ELISA |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | C1QBP |
| Omim ID: | 601269 |