| CatalogCode: | H00000673-M02 |
| ProductName: | v-raf murine sarcoma viral oncogene homolog B1 Antibody |
| Product Description: | Mouse Monoclonal anti-v-raf murine sarcoma viral oncogene homolog B1 (3D2) |
| Clone: | 3D2 |
| Clonality: | Monoclonal |
| Immunogen: | BRAF (NP_004324, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag. |
| Epitope: | FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRD ... |
| Specificity: | v-raf murine sarcoma viral oncogene homolog B1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a protein belonging to the raf/mil family of serine/threonine protein kinases. This protein plays a role in regulating the MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. Mutations in this gene are associated with cardiofaciocutaneous syndrome, a disease characterized by heart defects, mental retardation and a distinctive facial appearance. Mutations in this gene have also been associated with various cancers, including non-Hodgkin lymphoma, colorectal cancer, malignant melanoma, thyroid carcinoma, non-small cell lung carcinoma, and adenocarcinoma of lung. A pseudogene, which is located on chromosome X, has been identified for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-B-raf 1 antibody, anti-BRAF1 antibody, anti-MGC126806 antibody, anti-MGC138284 antibody, anti-RAFB1 antibody |
| ProteinTarget: | v-raf murine sarcoma viral oncogene homolog B1 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 673 |
| Gene_Symbol: | BRAF |
| Omim_ID: | 164757, 211980, |
order or more information: | company product webpage |
| request information: | |