| CatalogCode: | H00000639-M04 |
| ProductName: | PRDM1 Antibody |
| Product Description: | Mouse Monoclonal anti-PRDM1 (2F8) |
| Clone: | 2F8 |
| Clonality: | Monoclonal |
| Immunogen: | PRDM1 (NP_001189, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Epitope: | MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-BLIMP1 antibody, anti-MGC118922 antibody, anti-MGC118923 antibody, anti-MGC118924 antibody, anti-MGC118925 antibody, anti-PRDI-BF1 antibody |
| ProteinTarget: | PRDM1 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 639 |
| Gene_Symbol: | PRDM1 |
| Target_Reg: | PR domain containing 1, with ZNF domain |
| Omim_ID: | 603423, |