| Catalog Code: | H00000639-M03 |
| Product Type: | Primary Antibody |
| Product Name: | PRDM1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 639 |
| Host: | Mouse |
| Clone: | 1G6 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-PRDM1 (1G6) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induc |
| Alternate Names: | anti-BLIMP1 antibody, anti-MGC118922 antibody, anti-MGC118923 antibody, anti-MGC118924 antibody, anti-MGC118925 antibody, anti-PRDI-BF1 antibody |
| Immunogen: | PRDM1 (NP_001189, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Epitope: | MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Application Summary: | ELISA |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | PRDM1 |
| Omim ID: | 603423, |