ExactAntigen

PRDM1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000639-M03
Product Type:Primary Antibody
Product Name:PRDM1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:639
Host:Mouse
Clone:1G6
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-PRDM1 (1G6)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induc
Alternate Names:anti-BLIMP1 antibody, anti-MGC118922 antibody, anti-MGC118923 antibody, anti-MGC118924 antibody, anti-MGC118925 antibody, anti-PRDI-BF1 antibody
Immunogen:PRDM1 (NP_001189, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Epitope:MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PRDM1
Omim ID:603423,
see all human PRDM1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about