ExactAntigen

Mouse Polyclonal anti-BCL2L2
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00000599-A01
ProductName:BCL2L2 Antibody
Product Description:Mouse Polyclonal anti-BCL2L2
Clonality:Polyclonal
Immunogen:BCL2L2 (NP_004041, 1 a.a. ~ 93 a.a) partial recombinant protein with GST tag.
Epitope:MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPN* ...
Specificity:BCL2L2 - BCL2-like 2
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Background:This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host_Name:Mouse
ListPrice:225
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-BCL-W antibody, anti-BCLW antibody, anti-KIAA0271 antibody
ProteinTarget:BCL2L2 - BCL2-like 2
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:599
Gene_Symbol:BCL2L2
Omim_ID:601931 H00000599-B01
see all human BCL2L2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about