ExactAntigen

BAG1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000573-M02
Product Type:Primary Antibody
Product Name:BAG1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:573
Host:Mouse
Clone:2D3
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-BAG1 (2D3)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = BAG1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The oncogene BCL2 is
Immunogen:BAG1 (NP_004314, 241 a.a. ~ 346 a.a) partial recombinant protein with GST tag.
Epitope:EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE* ...
Specificity:BAG1 - BCL2-associated athanogene
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:BAG1
Omim ID:601497
see all human BAG1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about