| CatalogCode: | H00000572-M02 |
| ProductName: | Bad Antibody |
| Product Description: | Mouse Monoclonal anti-Bad (3H8) |
| Clone: | 3H8 |
| Clonality: | Monoclonal |
| Immunogen: | BAD (AAH01901, 69 a.a. ~ 168 a.a) partial recombinant protein with GST tag. |
| Epitope: | IRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ ... |
| Specificity: | BAD - BCL2-antagonist of cell death |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a lambda |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-Bcl-2 binding component 6 antibody, anti-BBC 2 antibody, anti-BBC2 antibody, anti-BBC6 antibody, anti-Bcl 2 Antagonist of Cell Death antibody, anti-Bcl 2 Binding Component 6 antibody, anti-BCL X / BCL 2 Binding Protein antibody, anti-BCL X Binding Protein antibody, anti-Bcl XL/Bcl 2 Associated Death Promoter antibody, anti-Bcl2 Associated Death Promoter antibody, anti-Bcl2 Like 8 Protein antibody, anti-BCL2L8 antibody, anti-BclXL antibody, anti-Proapoptotic BH3 Only Protein antibody |
| ProteinTarget: | BAD - BCL2-antagonist of cell death |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 572 |
| Gene_Symbol: | BAD |
| Omim_ID: | 603167 PAB0415 |