ExactAntigen

AXL Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000558-M01
Product Type:Primary Antibody
Product Name:AXL Antibody
List Price:275
Clonality:Monoclonal
Gene ID:558
Host:Mouse
Clone:6C8
Isotype:IgG2a kappa
Product Description:Mouse Monoclonal anti-AXL (6C8)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = AXL PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encoded b
Alternate Names:anti-UFO antibody, anti-AXL receptor tyrosine kinase antibody
Immunogen:AXL (AAH32229, 30 a.a. ~ 140 a.a) partial recombinant protein with GST tag.
Epitope:TQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPY ...
Specificity:AXL - AXL receptor tyrosine kinase
Purity:IgG purified
Packaging:0.1 ml IgG purified Mouse ascites.
Package Size:0.1 ml
Uses:Antibody reactive against immunizing protein in ELISA and Western Blot. GST tag alone was used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:AXL
Omim ID:109135,
see all human AXL antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about