ExactAntigen

Mouse Monoclonal anti-ATR (3F2) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00000545-M01
ProductName: ATR Antibody
Product Description: Mouse Monoclonal anti-ATR (3F2)
Clone: 3F2
Clonality: Monoclonal
Immunogen: ATR (NP_001175, 2545 a.a. ~ 2645 a.a) partial recombinant protein with GST tag.
Epitope: DQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM* ...
Specificity: ATR - ataxia telangiectasia and Rad3 related
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background: The protein encoded by this gene belongs the PI3/PI4-kinase family, and is most closely related to ATM, a protein kinase encoded by the gene mutated in ataxia telangiectasia. This protein and ATM share similarity with Schizosaccharomyces pombe rad3, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This kinase has been shown to phosphorylate checkpoint kinase CHK1, checkpoint proteins RAD17, and RAD9, as well as tumor suppressor protein BRCA1. Mutations of this gene are associated with Seckel syndrome. An alternatively spliced transcript variant of this gene has been reported, however, its full length nature is not known. Transcript variants utilizing alternative polyA sites exist.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG1 Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-Ataxia Telangiecasia and Rad3 Related antibody, anti-FRAP Related Protein 1 antibody, anti-FRP 1 antibody, anti-Human JTV 1 antibody, anti-protein kinase ATR antibody, anti-Rad3 related protein antibody, anti-SCKL antibody, anti-SCKL1 antibody, anti-Seckel syndrome antibody
ProteinTarget: ATR - ataxia telangiectasia and Rad3 related
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 545
Gene_Symbol: ATR
Omim_ID: 210600, 601215
more information: company product webpage
Also see:
see all human ATR antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about