| CatalogCode: | H00000526-M02 |
| ProductName: | ATP6V1B2 Antibody |
| Product Description: | Mouse Monoclonal anti-ATP6V1B2 (M1) |
| Clone: | M1 |
| Clonality: | Monoclonal |
| Immunogen: | ATP6V1B2 (AAH03100, 1 a.a. ~ 512 a.a) full length recombinant protein with GST tag. |
| Epitope: | MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMD ... |
| Specificity: | ATP6V1B2 - ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B, isoform 2 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. The protein encoded by this gene is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ATP6B1B2 antibody, anti-ATP6B2 antibody, anti-HO57 antibody, anti-VATB antibody, anti-VPP3 antibody, anti-Vma2 antibody |
| ProteinTarget: | ATP6V1B2 - ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B, isoform 2 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 526 |
| Gene_Symbol: | ATP6V1B2 |
| Omim_ID: | 606939 H00000528-A01 |
order or
more information: | company product webpage |
| request information: |
|