ExactAntigen

ATP6V1B2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00000526-M01
Product Type:Primary Antibody
Product Name:ATP6V1B2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:526
Host:Mouse
Clone:1A12-1E1
Isotype:IgG Mix Kappa
Product Description:Mouse Monoclonal anti-ATP6V1B2 (1A12-1E1)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sort
Alternate Names:anti-ATP6B1B2 antibody, anti-ATP6B2 antibody, anti-HO57 antibody, anti-VATB antibody, anti-VPP3 antibody, anti-Vma2 antibody
Immunogen:ATP6V1B2 (AAH03100, 1 a.a. ~ 512 a.a) full length recombinant protein with GST tag.
Epitope:MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMD ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:ATP6V1B2
Omim ID:606939
see all human ATP6V1B2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about