| Catalog Code: | H00000526-M01 |
| Product Type: | Primary Antibody |
| Product Name: | ATP6V1B2 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 526 |
| Host: | Mouse |
| Clone: | 1A12-1E1 |
| Isotype: | IgG Mix Kappa |
| Product Description: | Mouse Monoclonal anti-ATP6V1B2 (1A12-1E1) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sort |
| Alternate Names: | anti-ATP6B1B2 antibody, anti-ATP6B2 antibody, anti-HO57 antibody, anti-VATB antibody, anti-VPP3 antibody, anti-Vma2 antibody |
| Immunogen: | ATP6V1B2 (AAH03100, 1 a.a. ~ 512 a.a) full length recombinant protein with GST tag. |
| Epitope: | MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMD ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Application Summary: | ELISA |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | ATP6V1B2 |
| Omim ID: | 606939 |