| CatalogCode: | H00000523-A01 |
| ProductName: | ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A Antibody |
| Product Description: | Mouse Polyclonal anti-ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A |
| Clonality: | Polyclonal |
| Immunogen: | ATP6V1A (NP_001681, 508 a.a. ~ 618 a.a) partial recombinant protein with GST tag. |
| Epitope: | TLEVAKLIKDDFLQQNGYTPYDRFCPFYKTVGMLSNMIAFYDMARRAVETTAQSDNKITWSIIREHMGDILYKLSSMKFKDPLKDGEAKIKSDYAQLLEDMQNAFRSLED* ... |
| Specificity: | ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera |
| Background: | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c", and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ATP6A1 antibody, anti-ATP6V1A1 antibody, anti-HO68 antibody, anti-VA68 antibody, anti-VPP2 antibody, anti-Vma1 antibody |
| ProteinTarget: | ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 523 |
| Gene_Symbol: | ATP6V1A |
| Omim_ID: | 607027, |
order or
more information: | company product webpage |
| request information: |
|
|