ExactAntigen

Mouse Monoclonal anti-ATP2A3 (2H3) | Novus Biologicals antibody product information
CatalogCode:H00000489-M01
ProductName:ATP2A3 Antibody
Product Description:Mouse Monoclonal anti-ATP2A3 (2H3)
Clone:2H3
Clonality:Monoclonal
Immunogen:ATP2A3 (AAH35729, 501 a.a. ~ 621 a.a) partial recombinant protein with GST tag.
Epitope:TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIR* ...
Specificity:ATP2A3 - ATPase, Ca++ transporting, ubiquitous
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemistry on paraffin-embedded sections.
Background:This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB, IHC-P
SpeciesSummary:Hu
ALTnames:anti-SERCA3 antibody
ProteinTarget:ATP2A3 - ATPase, Ca++ transporting, ubiquitous
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:489
Gene_Symbol:ATP2A3
Omim_ID:601929 H00000490-M01
order or
more information
:
company product webpage
request information:
Also see:
all human ATP2A3 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about