| request information: |
|
| Catalog Code: | H00000487-M02 |
| Product Name: | ATP2A1 Antibody |
| Product Description: | Mouse Monoclonal anti-ATP2A1 (6F8) |
| Clone: | 6F8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 487 |
| Gene Symbol: | ATP2A1 |
| Omim ID: | 108730, 601003, |
| Immunogen: | ATP2A1 (NP_775293, 522 a.a. ~ 613 a.a) partial recombinant protein with GST tag. |
| Epitope: | IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGML
DPPRKEVTGSIQ* |
| Specificity: | ATP2A1 - ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in two transcript variants encoding different isoforms. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ATP2A antibody, anti-SERCA1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |