ExactAntigen

Mouse Monoclonal anti-ATP2A1 (1B11) | Novus Biologicals antibody product information
CatalogCode:H00000487-M01
ProductName:ATP2A1 Antibody
Product Description:Mouse Monoclonal anti-ATP2A1 (1B11)
Clone:1B11
Clonality:Monoclonal
Immunogen:ATP2A1 (NP_775293, 522 a.a. ~ 613 a.a) partial recombinant protein with GST tag.
Epitope:IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ* ...
Specificity:ATP2A1 - ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in two transcript variants encoding different isoforms.
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-ATP2A antibody, anti-SERCA1 antibody
ProteinTarget:ATP2A1 - ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:487
Gene_Symbol:ATP2A1
Omim_ID:108730, 601003,
order or
more information
:
company product webpage
request information:
Also see:
all human ATP2A1 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about