| request information: |
|
| Catalog Code: | H00000487-A01 |
| Product Name: | ATP2A1 Antibody |
| Product Description: | Mouse Polyclonal anti-ATP2A1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 487 |
| Gene Symbol: | ATP2A1 |
| Omim ID: | 108730 601003 |
| Immunogen: | ATP2A1 (NP_775293, 522 a.a. ~ 613 a.a) partial recombinant protein with GST tag. |
| Epitope: | IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGML
DPPRKEVTGSIQ* |
| Specificity: | ATP2A1 - ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in two transcript variants encoding different isoforms. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ATP2A antibody, anti-SERCA1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |