| request information: |
|
| Catalog Code: | H00000479-A01 |
| Product Name: | ATP12A Antibody |
| Product Description: | Mouse Polyclonal anti-ATP12A |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 479 |
| Gene Symbol: | ATP12A |
| Omim ID: | 182360 |
| Immunogen: | ATP12A (NP_001667, 174 a.a. ~ 282 a.a) partial recombinant protein with GST tag. |
| Epitope: | SSFNKMIPQQALVIRDSEKKTIPSEQLVVGDIVEVKGGDQIPADIRVLSSQGCRVDNSSLTGESEPQPRSSEFTHENPL
ETKNICFYSTTCLEASTSPVGTVTGMVIN* |
| Specificity: | ATP12A - ATPase, H+/K+ transporting, nongastric, alpha polypeptide |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This gene encodes a catalytic subunit of the ouabain-sensitive H+/K+ -ATPase that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for potassium absorption in various tissues. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ATP1AL1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |