| CatalogCode: | H00000475-M07 |
| ProductName: | ATOX1 Antibody |
| Product Description: | Mouse Monoclonal anti-ATOX1 (4A12) |
| Clone: | 4A12 |
| Clonality: | Monoclonal |
| Immunogen: | ATOX1 (NP_004036, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. |
| Epitope: | MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ATX1 antibody, anti-HAH1 antibody, anti-MGC138453 antibody, anti-MGC138455 antibody |
| ProteinTarget: | ATX1 antioxidant protein 1 homolog (yeast) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 475 |
| Gene_Symbol: | ATOX1 |
| Omim_ID: | 602270, |
order or more information: | company product webpage |
| request information: | |