| request information: | |
| Catalog Code: | H00000475-M03 |
| Product Name: | ATOX1 Antibody |
| Product Description: | Mouse Monoclonal anti-ATOX1 (3D10) |
| Clone: | 3D10 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 475 |
| Gene Symbol: | ATOX1 |
| Omim ID: | 602270, |
| Immunogen: | ATOX1 (NP_004036, 0 a.a. ~ 0 a.a) partial recombinant protein with GST tag. |
| Epitope: | MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ATX1 antibody, anti-HAH1 antibody, anti-MGC138453 antibody, anti-MGC138455 antibody |
| Package Size: | 0.05 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |