ExactAntigen

Mouse Monoclonal anti-ATOH1 (3B12) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00000474-M06
ProductName: ATOH1 Antibody
Product Description: Mouse Monoclonal anti-ATOH1 (3B12)
Clone: 3B12
Clonality: Monoclonal
Immunogen: ATOH1 (NP_005163, 266 a.a. ~ 355 a.a) partial recombinant protein with GST tag.
Epitope: PTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS* ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background: This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2a Kappa
Host_Name: Mouse
Buffer: In 1x PBS, pH 7.2
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-ATH1 antibody, anti-HATH1 antibody, anti-MATH-1 antibody
ProteinTarget: atonal homolog 1 (Drosophila)
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 474
Gene_Symbol: ATOH1
Omim_ID: 601461,
more information: company product webpage
Also see:
see all human ATOH1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about