| CatalogCode: | H00000474-M03 |
| ProductName: | ATOH1 Antibody |
| Product Description: | Mouse Monoclonal anti-ATOH1 (1F3) |
| Clone: | 1F3 |
| Clonality: | Monoclonal |
| Immunogen: | ATOH1 (NP_005163, 266 a.a. ~ 355 a.a) partial recombinant protein with GST tag. |
| Epitope: | PTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS* ... |
| Specificity: | ATOH1 - atonal homolog 1 (Drosophila) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-ATH1 antibody, anti-HATH1 antibody, anti-MATH-1 antibody |
| ProteinTarget: | ATOH1 - atonal homolog 1 (Drosophila) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 474 |
| Gene_Symbol: | ATOH1 |
| Omim_ID: | 601461, |
order or more information: | company product webpage |
| request information: | |