| request information: | |
| Catalog Code: | H00000467-M04 |
| Product Name: | ATF3 Antibody |
| Product Description: | Mouse Monoclonal anti-ATF3 (8G5) |
| Clone: | 8G5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 467 |
| Gene Symbol: | ATF3 |
| Omim ID: | 603148, |
| Immunogen: | ATF3 (AAH06322, 1 a.a. ~ 182 a.a) full length recombinant protein with GST tag. |
| Epitope: | MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKA EVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQ NGRTPEDERNLFIQQIKEGTLQS* |
| Specificity: | ATF3 - activating transcription factor 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | Activating transcription factor 3 is a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. Multiple transcript variants encoding two different isoforms have been found for this gene. The longer isoform represses rather than activates transcription from promoters with ATF binding elements. The shorter isoform (deltaZip2) lacks the leucine zipper protein-dimerization motif and does not bind to DNA, and it stimulates transcription presumably by sequestering inhibitory co-factors away from the promoter. It is possible that alternative splicing of the ATF3 gene may be physiologically important in the regulation of target genes. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG3 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu , |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |