| request information: |
|
| Catalog Code: | H00000443-M09 |
| Product Name: | aspartoacylase Antibody |
| Product Description: | Mouse Monoclonal anti-aspartoacylase (3C11) |
| Clone: | 3C11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 443 |
| Gene Symbol: | ASPA |
| Omim ID: | 271900, 608034, |
| Immunogen: | ASPA (NP_000040, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLG
KKMSEDLPYEVRRAQEINHLF* |
| Specificity: | aspartoacylase (Canavan disease) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ACY2 antibody, anti-ASP antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |