| request information: |
|
| Catalog Code: | H00000440-M01 |
| Product Name: | ASNS Antibody |
| Product Description: | Mouse Monoclonal anti-ASNS (3B3) |
| Clone: | 3B3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 440 |
| Gene Symbol: | ASNS |
| Omim ID: | 108370 |
| Immunogen: | ASNS (AAH14621, 281 a.a. ~ 381 a.a) partial recombinant protein with GST tag. |
| Epitope: | YPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQ ALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSG EGSDELTQGYIYFHKA* |
| Specificity: | ASNS - asparagine synthetase |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Localization: | Cytoplasmic |
| Background: | The protein encoded by this gene is involved in the synthesis of asparagine. This gene complements a mutation in the temperature-sensitive hamster mutant ts11, which blocks progression through the G1 phase of the cell cycle at nonpermissive temperature. There are three alternatively spliced transcript variants encoding the same protein described for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-NARS antibody, anti-3010001M15Rik antibody, anti-AA960128 antibody, anti-ASNRS antibody, anti-ASNS antibody, anti-Asparagine tRNA ligase 1, cytoplasmic antibody, anti-Asparagine tRNA ligase antibody, anti-Asparaginyl tRNA synthetase antibody, anti-C78150 antibody, anti-EC 6.1.1.22 antibody, anti-LRRGT00113 antibody, anti-MGC116236 antibody, anti-NARS1 antibody, anti-NRS antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |