| request information: |
|
| Catalog Code: | H00000439-M03 |
| Product Name: | ASNA1 Antibody |
| Product Description: | Mouse Monoclonal anti-ASNA1 (2H3) |
| Clone: | 2H3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 439 |
| Gene Symbol: | ASNA1 |
| Omim ID: | 601913, |
| Immunogen: | ASNA1 (NP_004308, 239 a.a. ~ 349 a.a) partial recombinant protein with GST tag. |
| Epitope: | PEQTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIVNQLVFPDPEKPCKMCEARHKIQAKYLDQMEDLYEDFHIVK
LPLLPHEVRGADKVNTFSALLLEPYKPPSAQ* |
| Specificity: | ASNA1 - arsA arsenite transporter, ATP-binding, homolog 1 (bacterial) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Background: | ASNA1 is the human homolog of the bacterial arsA gene. In E. coli, ArsA ATPase is the catalytic component of a multisubunit oxyanion pump that is responsible for resistance to arsenicals and antimonials.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-ARSA-I antibody, anti-ARSA1 antibody, anti-MGC3821 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |