| CatalogCode: | | H00000435-M01 |
| ProductName: | | ASL Antibody |
| Product Description: | | Mouse Monoclonal anti-ASL (4C5-1F2) |
| Clone: | | 4C5-1F2 |
| Clonality: | | Monoclonal |
| Immunogen: | | ASL (AAH08195, 1 a.a. ~ 465 a.a) full length recombinant protein with GST tag. |
| Epitope: | | MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSR ... |
| Specificity: | | ASL - argininosuccinate lyase |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates and has been used in immunofluorescence. |
| Background: | | This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG1 kappa |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB, IF |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-LP3236 antibody |
| ProteinTarget: | | ASL - argininosuccinate lyase |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 435 |
| Gene_Symbol: | | ASL |
| Omim_ID: | | 207900, 608310 |
| more information: | | company product webpage |