| request information: |
|
| Catalog Code: | H00000433-B01 |
| Product Name: | ASGR2 Antibody |
| Product Description: | Mouse Polyclonal anti-ASGR2 - asialoglycoprotein receptor 2 |
| Clone: | asialoglycoprotein receptor 2 |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 433 |
| Gene Symbol: | ASGR2 |
| Immunogen: | ASGR2 (AAH17251, 1 a.a. ~ 288 a.a) full-length human protein.MW of the GST tag alone is 26 KDa. |
| Epitope: | MAKDFQDIQQLSSEENDHPFHQGPPPAQPLAQRLCSMVCFSLLALSFNILLLVVICVTGSQSAQLQAELRSLKEAFSNF
SSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCCPVNWV
EHQGSCYWFSHSGKAWAEAEKYCQLENAHLVVINSWEEQRFIVQHTNPFNTWIGLTDSDGSWKWVDGTDYRHNYKNWAV
TQPDNWRGHELGGSEDCV |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This cell surface receptor binds to galactose-terminated glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociates. Then the receptor is recycled back to the cell surface. There are four alternatively spliced transcript variants of this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-ASGP-R antibody, anti-CLEC4H2 antibody, anti-Hs.1259 antibody, anti-L-H2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |